Product Description

CD300c Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0347-500, NCP0347-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: CD300 molecμles comprise a family of receptors that regμlate many immune cell processes. Cross-linking of CD300C by its specific antibody caused cytokine/chemokine production of human monocytes and mast cells. specific engagement of CD300C led to Fc receptor γ-dependent activation of mast cells and monocytes.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~24kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q08708

Tag: His-tag

Amino Acid Sequence: MGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Expression Vector: pet-22b(+)

Research Use Only