CD300c Recombinant Protein - NCP0347

CD300c Recombinant Protein

Catalogue Number: NCP0347-500, NCP0347-1000

Sizes: 500ug, 1mg

Swiss-Prot: Q08708

Host: E.coli

Tag: His-tag

AA Sequence: MGYFPLSHPMt VAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFt VTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Restriction Sites: NdeI-XhoI

Background: CD300 molecules comprise a family of receptors that regulate many immune cell processes. Cross-linking of CD300C by its specific antibody caused cytokine/chemokine production of human monocytes and mast cells. specific engagement of CD300C led to Fc receptor γ-dependent activation of mast cells and monocytes.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~24kDa

Notes: For research use only, not for use in diagnostic procedure.