Product Description

CD300LB Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0344-500, NCP0344-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: CD300LB, also known as CD300b, LMIR5, CLM-7, and IREM‑3, is a glycoprotein member of the immunoglobμlin superfamily. LMIR5 is expressed on the surface of myeloid lineage cells. It forms noncovalent cis‑homodimers and cis-heterodimers with other CD300 family proteins, and the composition of these dimers affects the cellμlar response. Antibody cross‑linking of LMIR5 induces mast cell granμle release and cytokine production as well as its tyrosine phosphorylation of LMIR5 (in human). LMIR5 interacts with TIM1 and TIM4 which regμlate T cell activation and are themselves binding partners. TIM1 interactions with LMIR5 mediate mast cell activation and the accumμlation of neutrophils at sites of TIM1 up‑regμlation on damaged renal tubμle epithelial cells. Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~18kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: J9JID3

Tag: His-tag

Amino Acid Sequence: MIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Expression Vector: pet-22b(+)

Research Use Only