Product Description

CD305 Recombinant Protein

Catalogue Number: NCP0313-500, NCP0313-1000

Sizes: 500ug, 1mg

Swiss-Prot: Q6GTX8

Host: E.coli

Tag: His-tag

AA Sequence: QEEDLPRPSISAEPGt VIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE
SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT
QRPSDNSHNEHAPASQGLKAEHLY

Restriction Sites: NdeI-XhoI

Background: LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~22kDa

Notes: For research use only, not for use in diagnostic procedure.