Skip to product information
1 of 1

Bioworld

CD305 Recombinant Protein - NCP0313

CD305 Recombinant Protein - NCP0313

Regular price $1,152.00 CAD
Regular price Sale price $1,152.00 CAD
Sale Sold out
Size
Quantity

Get a quote

CD305 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0313-500, NCP0313-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: LAIR-1 is an inhibitory receptor that belongs to the Immunoglobμlin superfamily. It has one extracellμlar Ig-like domain and an intracellμlar C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regμlatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregμlated in renal cell carcinoma, and may play a role in expansion of Th17 cell popμlations in collagen-rich environments, such as in graft rejection tissue.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~22kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q6GTX8

Tag: His-tag

Amino Acid Sequence: QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE
SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT
QRPSDNSHNEHAPASQGLKAEHLY

Expression Vector: pet-22b(+)

Research Use Only

View full details