Bioworld
CD305 Recombinant Protein - NCP0330
CD305 Recombinant Protein - NCP0330
Couldn't load pickup availability
CD305 Recombinant Protein
Sizes: 500μg, 1mg
Catalogue Numbers: NCP0330-500, NCP0330-1000
Lead times: 1-2 weeks, if manufacturer has product in stock
Manufacturer/Ship Location: China
Background: LAIR-1 is an inhibitory receptor that belongs to the Immunoglobμlin superfamily. It has one extracellμlar Ig-like domain and an intracellμlar C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regμlatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregμlated in renal cell carcinoma, and may play a role in expansion of Th17 cell popμlations in collagen-rich environments, such as in graft rejection tissue.
Category: Protein
Host: E. coli
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Molecular Weight: ~20kDa
Solubility: PBS, 4M Urea, PH7.4
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Restriction Sites: NdeI-XhoI
SwissProt: Q6GTX8
Tag: His-tag
Amino Acid Sequence: QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE
SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT
QRPSDNSHNEHAPASQGLKAEHLY
Expression Vector: pet-22b(+)
Research Use Only
