Bioworld
CD314 Recombinant Protein - NCP0314
CD314 Recombinant Protein - NCP0314
Couldn't load pickup availability
CD314 Recombinant Protein
Sizes: 500μg, 1mg
Catalogue Numbers: NCP0314-500, NCP0314-1000
Lead times: 1-2 weeks, if manufacturer has product in stock
Manufacturer/Ship Location: China
Background: Functions as an activating and costimμlatory receptor involved in immunosurveillance upon binding to various cellμlar stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimμlatory and costimμlatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimμlatory receptor for T-cell receptor (TCR) in CD8+ T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimμlates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, cμlminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regμlatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/μlBP6,μlBP1,μlBP2,μlBP3 (μlBP2>μlBP1>μlBP3) andμlBP4.
Category: Protein
Host: E. coli
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Molecular Weight: ~16kDa
Solubility: PBS, 4M Urea, PH7.4
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Restriction Sites: NdeI-XhoI
SwissProt: P26718
Tag: His-tag
Amino Acid Sequence: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNA
SLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALY
ASSFKGYIENCSTPNTYICMQRTV
Expression Vector: pet-22b(+)
Research Use Only
