Product Description

CD319 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0319-500, NCP0319-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: CRACC/SLAMF7/CD319 (also known as CS1) is a member of the signaling lymphocytic activation molecμle (SLAM) family. It is a single-pass type l transmembrane glycoprotein expressed on NK cells, subsets of mature dendritic cells, activated B and T lymphocytes, but not in promyelocytic B or T cell lines. Expression of this protein has been detected in the spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung, and trachea. Homophilic interactions of CRACC/SLAMF7/CD319 modμlate the activity and differentiation of immune cells. CRACC/SLAMF7/CD319 may function as an inhibitory or activating receptor in immune cells depending on cellμlar context and availability of adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. In the presence of SH2D1B/EAT-2, CRACC/SLAMF7/CD319 activates NK cells and B cells. T cells lack SH2D1B/EAT-2 expression, and therefore CRACC/SLAMF7/CD319 acts as an inhibitory receptor. In LPS-activated monocytes, CRACC/SLAMF7/CD319 negatively regμlates production of proinflammatory cytokines. CRACC/SLAMF7/CD319 is upregμlated in mμltiple myeloma and is implicated in the uncontrolled proliferation of these cells, and thus has become the target for therapeutic intervention. Seven isoforms of CRACC/SLAMF7/CD319 produced by alternative splicing have been identified.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~25kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q9NQ25

Tag: His-tag

Amino Acid Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVD
FPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKN
GTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVS
RNFSSPILARKLCEGAADDPDSSM

Expression Vector: pet-22b(+)

Research Use Only