Product Description

CD321 Recombinant Protein

Catalogue Number: NCP0316-500, NCP0316-1000

Sizes: 500ug, 1mg

Swiss-Prot: Q9Y624

Host: E.coli

Tag: His-tag

AA Sequence: SVt VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRV
TFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPt VNIPSSATIGN
RAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDT
GEYSCEARNGYGTPMTSNAVRMEAVERNVGV

Restriction Sites: NdeI-XhoI

Background: Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3.
The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly.
Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~26kDa

Notes: For research use only, not for use in diagnostic procedure.