Product Description

CD327 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0328-500, NCP0328-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: Two families of mammalian lectin-like adhesion molecμles, the selectins and the sialoadhesins, bind glycoconjugate ligands in a sialic acid-dependent manner. The sialic acid-binding immunoglobμlin superfamily lectins, designated Siglecs or sialoadhesins, recognize sialylated ligands and play a key role in mediating sialic-acid dependent binding to cells. Siglec-6, also called obesitybinding protein 1, is an adhesion molecμle that is highly expressed in placental trophoblasts, as well as in peripheral blood leukocytes. Siglec-6 can bind both
N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc), the two common sialic acids found in mammalian cells. Together with the other members of the Siglec family, Siglec-6 promotes cell-cell interactions and plays a roll in the innate and adaptive immune systems through glycan recognition.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~35kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: O43699

Tag: His-tag

Amino Acid Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQ
EETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTH
RPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRP
QDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLE
GQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLG
SLQISLSLFVHWKPEGRAGGV

Expression Vector: pet-22b(+)

Research Use Only