Product Description

CD329 Recombinant Protein

Catalogue Number: NCP0332-500, NCP0332-1000

Sizes: 500ug, 1mg

Swiss-Prot: Q9Y336

Host: E.coli

Tag: His-tag

AA Sequence: SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKP
GFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHG
RCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGS
PCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGV
QCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEAC
EPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDt VTGDCVCSAGYWGP
SCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT

Restriction Sites: NdeI-XhoI

Background: Two families of mammalian lectin-like adhesion molecules bind glycoconjugate ligands in a sialic acid-dependent manner: the selectins and the sialoadhesins. The sialic acid-binding immunoglobulin superfamily lectins, designated siglecs or sialoadhesins, are immunoglobulin superfamily members recognizing sialylated ligands. The common sialic acids of mammalian cells are N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc). Siglec-1 mediates local cell-cell interactions in lymphoid tissues and can be detected at contact points of macrophages with other macrophages, sinus-lining cells and reticulum cells. Siglec-7, highly expressed in monocytes and resident blood cells but not in parenchymatous cells, mediates inhibition of natural killer cell cytotoxicity. Siglec-9 is closely homologous to Siglec-7. It is highly expressed in peripheral blood leukocytes (not eosinophils), liver, bone marrow, placenta and spleen. Siglec-8, a type I membrane protein, is selectively expressed on human eosinophils, basophils and mast cells, where it regulates their function and survival.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~42kDa

Notes: For research use only, not for use in diagnostic procedure.