BioWorld
CD33 Recombinant Protein - NCP0351
CD33 Recombinant Protein - NCP0351
Couldn't load pickup availability
CD33 Recombinant Protein
Catalogue Number: NCP0351-500, NCP0351-1000
Sizes: 500ug, 1mg
Swiss-Prot: P20138
Host: E.coli
Tag: His-tag
AA Sequence: DPNFWLQVQESVt VQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNK
LDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVH
VTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL
IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGV
VH
Restriction Sites: NdeI-XhoI
Background: CD33, a type I transmembrane protein, is a sialic acid-binding Ig-like lectin (Siglec-3) of the Ig superfamily, and human CD33 binds preferentially to alpha-2, 6-linked sialic acid. Upon binding to its ligands CD33 transduces an inhibitory signaling through the immunoreceptor tyrosine-based inhibitory motif (ITIM) in its intracellular domain, inhibiting cellular function such as phagocytosis. In addition, CD33 is also involved in other processes, such as adhesion. Due to its exclusive expression on hematopoietic cells, particularly the myeloid lineage and their progenitors, CD33 has been actively pursued as a therapeutic target against acute myeloid leukemia (AML). CD33 may also be involved in Alzheimer’s Disease.
Soluble: PBS, 4M Urea, PH7.4
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression Vector: pet-22b(+)
BioWorld Molecular Weight: ~33kDa
Notes: For research use only, not for use in diagnostic procedure.