Product Description

CD58 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0323-500, NCP0323-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellμlar domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~24kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: P19256

Tag: His-tag

Amino Acid Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSG
SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHY
NSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS
SGHSRHR

Expression Vector: pet-22b(+)

Research Use Only