Product Description

CD62E Recombinant Protein

Catalogue Number: NCP0360-500, NCP0360-1000

Sizes: 500ug, 1mg

Swiss-Prot: P16581

Host: E.coli

Tag: His-tag

AA Sequence: MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGt VCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Restriction Sites: NdeI-XhoI

Background: Selectins, also designated CD62 antigens, comprise a family of carbohydratebinding proteins involved in mediating cellular interactions with leukocytes. L-Selectin (also designated LECAM-1 or CD62L) is expressed on the majority of B and naive T cells and on most monocytes, neutrophils and eosinophils. L-Selectin interacts with specific carbohydrates expressed by activated endothelial cells. P-Selectin (also designated GMP-140 or CD62P), expressed on activated platelets and endothelial cells, and E-Selectin (also designated ELMA-1 or CD62E), expressed on endothelial cells, exhibit overlapping ligand specificities. E-Selectin is expressed by cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~62kDa

Notes: For research use only, not for use in diagnostic procedure.