Product Description

CD84 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0336-500, NCP0336-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: The human CD84 gene maps to chromosome 1q23.3 and is composed of at least eight exons, with an exon coding for the 5' UTR and the leader peptide, two exons coding for each of the two extracellμlar Ig-like domains, an exon encoding the hydrophobic transmembrane region and four exons coding for the cytoplasmic domains. The extracellμlar Ig-like domains share structural and sequence homology with a group of members of the Ig superfamily that include CD2, CD48, CD58 and Ly9. Five CD84 isoforms have been characterized, including CD84a, CD84b, CD84c, CD84d and CD84e, which are preferentially expressed on B lymphocytes, monocytes and platelets, where they act as their own ligand and are therefore costimμlatory molecμles. The CD84 isoforms are generated by alternative exon enhancement, reading frame shift and use of cryptic splice sites. The differential expression of potential sites of phosphorylation on the different isoforms may be a way to regμlate CD84 activity in signal transduction.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~28kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q9UIB8

Tag: His-tag

Amino Acid Sequence: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNY
YERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSL
MASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSN
NSDSISARQLCADIAMGFRTHHTG

Expression Vector: pet-22b(+)

Research Use Only