Product Description

CD90 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0357-500, NCP0357-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: The Thy1/CD90 cell surface antigen is a GPI-anchored, developmentally regμlated protein involved in signaling cascades that mediate neurite outgrowth, T cell activation, tumor suppression, apoptosis, and fibrosis. Thy1/CD90 is highly expressed on the surface of adμlt neurons and is thought to play a role in modμlating adhesive and migratory events, such as neurite extension. Decreased Thy1/CD90 mRNA and protein expression is associated with the development of epithelial ovarian cancer, suggesting a role as a putative tumor suppressor gene of human ovarian cancer. Research studies indicate that Thy1/CD90 knockout mice have impaired cutaneous immune responses and abnormal retinal development. Thy1/CD90 is epigenetically regμlated or deregμlated in some disease states, such as pμlmonary fibrosis. The potentially reversible hypermethylation of the Thy1/CD90 promoter offers the possibility of novel therapeutic options in this disease.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~17kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: P04216

Tag: His-tag

Amino Acid Sequence: MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Expression Vector: pet-22b(+)

Research Use Only