BioWorld
CD94 Recombinant Protein - NCP0325
CD94 Recombinant Protein - NCP0325
Couldn't load pickup availability
CD94 Recombinant Protein
Catalogue Number: NCP0325-500, NCP0325-1000
Sizes: 500ug, 1mg
Swiss-Prot: Q13241
Host: E.coli
Tag: His-tag
AA Sequence: KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCAS
QKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKN
CIAYNPNGNALDESCEDKNRYICKQQLI
Restriction Sites: NdeI-XhoI
Background: The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms on the surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, γδ T cells, and CD8+ αβ T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors.
Soluble: PBS, 4M Urea, PH7.4
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression Vector: pet-22b(+)
BioWorld Molecular Weight: ~19kDa
Notes: For research use only, not for use in diagnostic procedure.