Product Description

IL-1 beta Polyclonal Antibody

Product: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide, pH 7.3.

Sizes: 50µl, 100µl

Catalogue Numbers: BZ17067-50, BZ17067-100

Swiss-Prot: P01584

Host: Rabbit

IL-1 beta Polyclonal Antibody-BZ17067

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Reactivity: Human, Mouse, Rat

Applications: WB,

All Applications: WB: 1/500-1/1000

Background: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Purification and Purity: Affinity Purified

Specificity: IgG

Bioworld Molecular Weight: Calculated MW: 31 kDa; Observed MW: 31 kDa

Note: For research use only, not for use in diagnostic procedure.

Extra Notes: Western blot analysis of IL-1 beta in various cell linesLysates using IL-1B antibody., Western blot analysis of IL-1 beta in various cell linesLysates using IL-1B antibody.

Alternative Name: IL1B; IL1F2; Interleukin-1 beta; IL-1 beta; Catabolin

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN

Modification: Unmodified

Conjugate: Unconjugated