Skip to product information
1 of 1

BioWorld

PDM1 Recombinant Protein - NCP0381

PDM1 Recombinant Protein - NCP0381

Regular price $1,050.83 CAD
Regular price Sale price $1,050.83 CAD
Sale Sold out
Size
Quantity

Get a quote

PDM1 Recombinant Protein

Catalogue Number: NCP0381-500, NCP0381-1000

Sizes: 500ug, 1mg

Swiss-Prot: P31368

Host: E.coli

Tag: His-tag

AA Sequence: mvmselrwhtaspednknslkrdllkstptsareaavhimqnryisrlsrspsplqsnasdcddnnssvgtssdrcrsplspalslshqqakrqlmslqphpahhhhnphhlnhlnhhqykqeedyddanggalnltsdnsrhstqspsnsvksataspvpvisvpspvppmispvlapsgcgsttpnsmaaaaaaaaavastmgsgispllalpgmsspqaqlaaaglgmnnplltgslspqdfaqfhqllqqrqvaltqqfnsymellrsgslglaqddpaltaqvaaaqflmqsqlqalsqasqqlqalqkqqqrqvdeplqlnhkmtqqprsstphsirspiairspasspqqlhhhhhhplqitppssaaslklsgmltpstptsgtqmsqgtttpqpkt Vasaaaaraagepspeettdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklkpllqkwlddadrtiqatggvfdpaalqat Vstpeiigrrrkkrtsiettirgalekaflanqkptseeitqladrlsmekevvrvwfcnrrqkekrinpsldsptgadddessymmh

Restriction Sites: NdeI-XhoI

Background: DNA-binding regulatory protein implicated in early development. Involved in neuronal cell fate decision. Repressed directly or indirectly by the BX-C homeotic proteins.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~66kDa

Notes: For research use only, not for use in diagnostic procedure.

View full details