ABclonal
Recombinant African swine fever virus P30 Protein - RP01934LQ
Recombinant African swine fever virus P30 Protein - RP01934LQ
Couldn't load pickup availability
Recombinant African swine fever virus P30 Protein
Sizes: 10ug, 20ug
Catalogue Number: RP01934LQ-10, RP01934LQ-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Recombinant African swine fever virus P30 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ile86-Lys194)of African swine fever virus P30 (Accession #P34204) fused with no tag.
Alternate Names: p30
SWISS: P34204
GeneID: P34204
Species: African swine fever virus
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: ASFV structural protein p30 is a significant immunogen reported to induce neutralizing antibodies against it. The p30 interacts with heterologous nuclear ribonucleoprotein K (hnRNPK) in the host cell and could downregulate the host cell mRNA translation (Hernaez et al., 2008). Moreover, p30 is an excellent diagnostic marker for ASFV, and anti-p30 antibodies can be detected as early as eight days post-infection (Gómez-Puertas et al., 1998).We and others previously showed the epitopic domains of the p30 protein, which could potentially generate the host immune response (Afonso et al., 1992; Imdhiyas et al., 2022; Petrovan et al., 2019).
Source: E. coli
Tag: NO-Tag
Formulation: Supplied as 0.22 μm filtered solution in PBS,300 mM NaCl,10% glycerol, (pH 7.4).
Antigen Sequence: ILHVLFEEETESSASSENIHEKNDNETNECTSSFETLFEQEPSSEVPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIYGTPLKEEEKEVVRLMVIKLLKKK
Endotoxin: Please contact us for more information.
Research Use Only
