Skip to product information
1 of 1

BioWorld

Recombinant BDNF, Human - BK0184

Recombinant BDNF, Human - BK0184

Regular price $217.41 CAD
Regular price Sale price $217.41 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant BDNF, Human

Catalogue Numbers: BK0184-5, BK0184-25

Sizes: 5μg, 25μg

Source: CHO

Molecular Weight: 12-14kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50<4μg/ml, measured in a bioassay using C6 cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGt Vt VLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC
RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Endotoxin: <0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant human BDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human BDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.

View full details