Recombinant CT-1, Human
Catalogue Numbers: BK0191-10, BK0191-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 24~26kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE.
Biological Activity: ED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL
PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA
ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Human Cardiotrophin-1(CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1(CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues.