ABclonal
Recombinant Cynomolgus IL-2RG/CD132 Protein - RP01424
Recombinant Cynomolgus IL-2RG/CD132 Protein - RP01424
Couldn't load pickup availability
Recombinant Cynomolgus IL-2RG/CD132 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01424-10, RP01424-20, RP01424-50, RP01424-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Cynomolgus IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of cynomolgus (rhesus macaque) IL-2 R gamma/CD132 (Accession #NP_001030606.1) fused with a Fc, Avi tag at the C-terminus.
Alternate Names: IL2RG, CD132, CIDX, IMD4, P64, SCIDX, SCIDX1, gammaC, IL2RG
SWISS: Q38JL2
GeneID: 641338
Species: Cynomolgus
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The common gamma chain (γc) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. The common gamma chain (γc) (or IL2RG), is a cytokine receptor subunit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15, and the interleukin-21 receptor. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. X-linked severe combined immunodeficiency (X-SCID) is a rare and potentially fatal disease caused by mutations of IL2RG, the gene encoding IL2RG. IL2RG was demonstrated to be a component of the IL-4 receptor based on chemical cross-linking data, the ability of IL2RG to augment IL-4 binding affinity. The observation that IL-2R gamma is a functional component of the IL-4 receptor, together with the finding that IL-2R gamma associates with the IL-7 receptor, begins to elucidate why a deficiency of this common gamma chain (gamma c) has a profound effect on lymphoid function and development, as seen in X-linked severe combined immunodeficiency.
Source: HEK293 cells
Tag: C-hFc&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKEN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
