BioWorld
Recombinant Epigen, Human (CHO-expressed) - BK0197
Recombinant Epigen, Human (CHO-expressed) - BK0197
Couldn't load pickup availability
Recombinant Epigen, Human (CHO-expre Ssed)
Catalogue Numbers: BK0197-10, BK0197-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 15~20 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE.
Biological Activity: ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: AVt VTPPITAQQGNWt VNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY
A
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.