WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant FasR, Human - BK0303

Recombinant FasR, Human - BK0303

Regular price
$256.94
Regular price
Sale price
$256.94
Unit price
per 
Availability
Sold out

Recombinant FasR, Human

Catalogue Numbers: BK0303-10, BK0303-50

Sizes: 10μg, 50μg

Source: HEK 293

Molecular Weight: 17~29 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 <0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: QVTDINSKGLELRKt VTt VETQNLEGLHHDGQFCHKPCPPGERKARDCt VNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR
LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSt VCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.