Skip to product information
1 of 1

ABclonal

Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein - RP01301LQ

Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein - RP01301LQ

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein

Sizes: 10ug, 100ug

Catalogue Number: RP01301LQ-10, RP01301LQ-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu17-Val392) of hcov-oc43 Coronavirus Hemagglutinin esterase (Accession #YP_009555240.1) fused with a 6×His tag at the C-terminus.

Alternate Names: Hemagglutinin esterase (HE) , Hemagglutinin esterase (HE)

SWISS: P30215

GeneID: 39105216

Species: HCoV-OC43

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Source: HEK293 cells

Tag: C-His

Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Antigen Sequence: LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADINIPDLPICVYDPLPV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details