ABclonal
Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein - RP01301LQ
Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein - RP01301LQ
Couldn't load pickup availability
Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein
Sizes: 10ug, 100ug
Catalogue Number: RP01301LQ-10, RP01301LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu17-Val392) of hcov-oc43 Coronavirus Hemagglutinin esterase (Accession #YP_009555240.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Hemagglutinin esterase (HE) , Hemagglutinin esterase (HE)
SWISS: P30215
GeneID: 39105216
Species: HCoV-OC43
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Source: HEK293 cells
Tag: C-His
Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Antigen Sequence: LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADINIPDLPICVYDPLPV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
