Recombinant Human 12E7/MIC2 /CD99 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01050-10, RP01050-20, RP01050-50, RP01050-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human 12E7/MIC2 /CD99 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp23-Asp122) of human CD99 (Accession #NP_002405.1.) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, CD99 antigen, HBA71, MIC2, MIC2X, MIC2Y, MSK5X
SWISS: P14209-1
GeneID: 4267
Species: Human
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized PE anti-human CD99 Antibody at 1μg/mL (100 μL/well) can bind Human CD99 with a linear range of 0.46-9.4 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only