ABclonal
Recombinant Human Activin RIIB/ACVR2B Protein - RP00153
Recombinant Human Activin RIIB/ACVR2B Protein - RP00153
Couldn't load pickup availability
Recombinant Human Activin RIIB/ACVR2B Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00153-10, RP00153-20, RP00153-50, RP00153-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Activin RIIB/ACVR2B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser19-Thr134) of human ACVR2B/Activin RIIB (Accession #NP_001097.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: ACVR2B, ACTRIIB, ActR-IIB, HTX4
SWISS: Q13705
GeneID: 93
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human ACVR2B at 1 μg/mL (100 μL/well) can bind Human BMPRIA with a linear range of 0.5-62.5 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized Human CD105 at 1 μg/mL (100 μL/well) can bind Human ACVR2B with a linear range of 0.49-43.03 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
