ABclonal
Recombinant Human AGER/RAGE Protein - RP00154
Recombinant Human AGER/RAGE Protein - RP00154
Couldn't load pickup availability
Recombinant Human AGER/RAGE Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00154-20, RP00154-50, RP00154-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human AGER/RAGE Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln24-Ala344) of human AGER/RAGE (Accession #NP_001127.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: AGER, RAGE, SCARJ1
SWISS: Q15109
GeneID: 177
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE; ≥ 90% as determined by HPLC.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Receptor for Advanced Glycosylation End Products (RAGE, or AGER) is a member of the immunoglobulin super-family transmembrane proteins, as a signal transduction receptor which binds advanced glycation endproducts, certain members of the S100/calgranulin family of proteins, high mobility group box 1 (HMGB1), advanced oxidation protein products, and amyloid (beta-sheet fibrils). It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as atherosclerosis, arthritis, Alzheimer's disease, atherosclerosis and aging associated diseases.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant human HMGB1 at 2 μg/mL (100 μL/well) can bind Recombinant human AGER with a linear range of 15-50 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human S100A12 at 2 μg/mL (100 μL/well) can bind recombinant Human AGER/RAGE, the EC50 of Human AGER/RAGE is 27.25 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
