Skip to product information
1 of 1

Elabscience

Recombinant Human AITRL protein(N-His)(active) - PKSH034121

Recombinant Human AITRL protein(N-His)(active) - PKSH034121

Regular price $1,034.60 CAD
Regular price Sale price $1,034.60 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Human AITRL protein(N-His)(active)

Size: 100μg

Catalogue Number: PKSH034121-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: AITRL

Target Symptom: TL6; GITRL; TNLG2A; hGITRL; TNFSF18

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q9UNG2

Accession: Q9UNG2

Background: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 2. 5 ng/mL.

Sequence: MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 21.13 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details