Recombinant Human ALK-1/ACVRL1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00978-10, RP00978-20, RP00978-50, RP00978-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human ALK-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp22-Gln118) of human ALK-1 (Accession #NP_000011.2) fused with a 6×His tag at the C-terminus.
Alternate Names: ACVRL1, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I
SWISS: P37023
GeneID: 94
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ALK-1 at 4 μg/mL (100 μL/well) can bind Human ACVR2B with a linear range of 0.08-2.4 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Endotoxin: Please contact us for more information.
Research Use Only