Recombinant Human ALK-4/ACVR1B Protein
Sizes: 50ug, 100ug
Catalogue Number: RP00074-50, RP00074-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Glu 126) of human ACVR1B (Accession #NP_004293.1) fused with a C-hFc＆his at the C-terminus.
Alternate Names: ACTRIB, ACVRLK4, ALK4, SKR2, ACVR1B, ACVRLK4, ALK4, SKR2
SWISS: P36896-1
GeneID: 91
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: ALK-4 (Activin Receptor-Like Kinase 4) or ACVR1B (Activin A Receptor, type 1B), belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, and TGFB receptor subfamily. ALK-4/ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B. The known type II activin receptors include ActRII and ActRIIB, while the main type I activin receptor in mammalian cells is ALK-4 (ActRIB). In the presence of activin, type II and type I receptors form complexes whereby the type II receptors activate ALK-4 through phosphorylation. The activated ALK-4, in turn, transduces signals downstream by phosphorylation of its effectors, such as Smads, to regulate gene expression and affect cellular phenotype. ALK-4/ACVR1B is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ACVR1B at 0.5 μg/mL (100 μL/well) can bind Human ACVR2B with a linear range of 2.0-286.1 ng/mL.
Source: HEK293 cells
Tag: C-hFc＆his
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only