ABclonal
Recombinant Human Alpha-synuclein/SNCA Protein - RP01694
Recombinant Human Alpha-synuclein/SNCA Protein - RP01694
Couldn't load pickup availability
Recombinant Human Alpha-synuclein/SNCA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01694-10, RP01694-20, RP01694-50, RP01694-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Alpha-synuclein/SNCA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala140) of human Alpha-synuclein/SNCA (Accession #NP_000336.1) fused with no additional amino acid.
Alternate Names: PD1; NACP; PARK1; PARK4; SNCA
SWISS: P37840-1
GeneID: 6622
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Alpha-Synuclein (alpha-Syn), also known as NACP or SNCA, exists as at least two structural isoforms: one is helix-rich, membrane-bound form that both the N- and C-terminal regions of alpha-synuclein are tightly associated with membranes and the other is disordered, cytosolic form. Synuclein is found predominantly in the presynaptic termini, in both free or membrane-bound forms. SNCA is extensively localized in nucleus of neurons. It has been shown that alpha-Synuclein was highly expressed in the mitochondria in olfactory bulb, hippocampus, striatum, and thalamus, where the cytosolic alpha-Synuclein was also rich.
Source: E. coli
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
