ABclonal
Recombinant Human AMBP Protein - RP02794
Recombinant Human AMBP Protein - RP02794
Couldn't load pickup availability
Recombinant Human AMBP Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02794-10, RP02794-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human AMBP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly20-Val203) of human AMBP (Accession #NP_001624.1) fused with a 6×His tag at the C-terminus.
Alternate Names: A1M; HCP; ITI; UTI; EDC1; HI30; ITIL; IATIL; ITILC; AMBP
SWISS: P02760
GeneID: 259
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: α-1-microglobulin, inter-α-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. α-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-α-trypsin inhibitor is present in the plasma and urine. α-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-α-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
