Skip to product information
1 of 1

ABclonal

Recombinant Human AMBP Protein - RP02794

Recombinant Human AMBP Protein - RP02794

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human AMBP Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02794-10, RP02794-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human AMBP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly20-Val203) of human AMBP (Accession #NP_001624.1) fused with a 6×His tag at the C-terminus.

Alternate Names: A1M; HCP; ITI; UTI; EDC1; HI30; ITIL; IATIL; ITILC; AMBP

SWISS: P02760

GeneID: 259

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: α-1-microglobulin, inter-α-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. α-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-α-trypsin inhibitor is present in the plasma and urine. α-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-α-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details