ABclonal
Recombinant Human AMHR2/MISR2 Protein - RP01962
Recombinant Human AMHR2/MISR2 Protein - RP01962
Couldn't load pickup availability
Recombinant Human AMHR2/MISR2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01962-10, RP01962-20, RP01962-50, RP01962-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro18-Ser144) of Human AMHR2/MISR2(Accession #Q16671) fused with a hFC tag at the C-terminus.
Alternate Names: AMHR2, AMHR, MISR2, Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII
SWISS: Q16671
GeneID: 269
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: AMHR2, On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: PNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
