Recombinant Human AMHR2/MISR2 Protein - RP01962

Recombinant Human AMHR2/MISR2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01962-10, RP01962-20, RP01962-50, RP01962-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro18-Ser144) of Human AMHR2/MISR2(Accession #Q16671) fused with a hFC tag at the C-terminus.

Alternate Names: AMHR2, AMHR, MISR2, Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII

SWISS: Q16671

GeneID: 269

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: AMHR2, On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: PNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only