Recombinant Human AMHR2/MISR2 Protein - RP01982

Recombinant Human AMHR2/MISR2 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01982-20, RP01982-50, RP01982-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala17-Ser144) of Human AMHR2/MISR2 (Accession #NP_065434.1) fused with His at the C-terminus.

Alternate Names: AMHR2, AMHR, MISR2, Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII

SWISS: Q16671

GeneID: 269

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: AMHR2, On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only