ABclonal
Recombinant Human Amphiregulin/AREG Protein - RP00898
Recombinant Human Amphiregulin/AREG Protein - RP00898
Couldn't load pickup availability
Recombinant Human Amphiregulin/AREG Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00898-10, RP00898-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Amphiregulin/AREG Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser101-Lys198) of Human Amphiregulin/AREG (Accession #P15514) fused with an initial Met at the N-terminus.
Alternate Names: AREG, AR, AREGB, CRDGF, SDGF, amphiregulin
SWISS: P15514
GeneID: 374
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 5-15 ng/mL.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
