ABclonal
Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein - RP01828
Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein - RP01828
Couldn't load pickup availability
Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01828-10, RP01828-20, RP01828-50, RP01828-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg277-Phe498) of human Angiopoietin-1/ANG-1/ANGPT1 (Accession #NP_001137.2) fused with a 6×His tag at the
Alternate Names: AGP1; AGPT; ANG1; HAE5; AGPT-1; Angiopoietin-1; ANG-1; ANGPT1
SWISS: Q15389-1
GeneID: 284
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The angiopoietin (ANGPT)-TIE2/TEK signaling pathway is essential for blood and lymphatic vascular homeostasis. ANGPT1 is a potent TIE2 activator, whereas ANGPT2 functions as a context-dependent agonist/antagonist. In disease, ANGPT2-mediated inhibition of TIE2 in blood vessels is linked to vascular leak, inflammation, and metastasis.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: KREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
