Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02008-10, RP02008-20, RP02008-50, RP02008-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by mammalian expression system. The target protein is expressed with sequence (Lys275-Phe496) of human Angiopoietin-2/ANGPT2 (Accession #O15123) fused with 6xHis at the C-terminus.
Alternate Names: AGPT2, ANG2, ANGPT2, ANG2
SWISS: O15123-1
GeneID: 285
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Angiopoietin-2 (Ang-2; also ANGPT2) is a secreted glycoprotein that plays a complex role in angiogenesis and inflammation. Mature Ang-2 is 478 amino acids in length.Ang2 is widely expressed during development, but it is restricted postnatally to highly angiogenic tissues such as the placenta, ovaries, and uterus. It is particularly abundant in vascular endothelial cells (EC) where it is stored in intracellular Weibel Palade bodies.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM MOPS 150 mM NaCl 0.05% CHAPS pH 7.0.
Antigen Sequence: KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only