Recombinant Human Angiopoietin-4/ANG-4/ANGPT4(23-503) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01773-10, RP01773-20, RP01773-50, RP01773-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Angiopoietin-4/ANG-4/ANGPT4(23-503) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Ile503) of human ANG-4/ANGPT4 (Accession #NP_057069.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: ANG3; ANG4
SWISS: Q9Y264
GeneID: 51378
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Human Angiopoietin-4 (Ang-4) (1), alternatively named Ang-3 (2), is a secreted glycoprotein belonging to the angiopoietin family. It has the characteristic structural motifs of angiopoietins including the coiled-coiled domain near the amino-terminus and a fibrinogen-like domain at the C-terminus.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only