ABclonal
Recombinant Human Angiopoietin-like 3/ANGPTL3(17-220) Protein - RP01024
Recombinant Human Angiopoietin-like 3/ANGPTL3(17-220) Protein - RP01024
Couldn't load pickup availability
Recombinant Human Angiopoietin-like 3/ANGPTL3(17-220) Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01024-20, RP01024-50, RP01024-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Angiopoietin-like 3/ANGPTL3(17-220) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser17-Pro220) of human ANGPTL3/Angiopoietin-like 3 (Accession #NP_055310.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ANG-5, ANGPT5, ANL3, FHBL2, ANGPTL3, ANGPT5, ANL3, FHBL2
SWISS: Q9Y5C1
GeneID: 27329
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Angiopoietin-like protein 3 (ANGPTL3) also known as Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5) is a secreted glycoprotein that is structurally related to the angiopoietins.Human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. The fibrinogen C-terminal domain is sufficient to mediate endothelial cell adhesion. ANGPTL3 is principally expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism.ANGPTL3 directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
