Skip to product information
1 of 1

ABclonal

Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein - RP02866

Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein - RP02866

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02866-10, RP02866-20, RP02866-50, RP02866-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser17-Glu460) of human Angiopoietin-like 3/ANGPTL3 (Accession #NP_055310.1) fused with a 6×His tag at the C-terminus.

Alternate Names: ANG-5, ANGPT5, ANL3, FHBL2, ANGPTL3, ANGPT5, ANL3, FHBL2, ANGPTL3

SWISS: Q9Y5C1

GeneID: 27329

Species: Human

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Angiopoietin-like protein 3 (ANGPTL3) also known as Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5) is a secreted glycoprotein that is structurally related to the angiopoietins.Human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. The fibrinogen C-terminal domain is sufficient to mediate endothelial cell adhesion. ANGPTL3 is principally expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism.ANGPTL3 directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% CHAPS, pH7.4.

Antigen Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details