Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01831-10, RP01831-20, RP01831-50, RP01831-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val237-Glu460) of human Angiopoietin-like 3/ANGPTL3 (Accession #NP_055310.1) fused with a 6×His tag at the
Alternate Names: ANL3; ANG-5; FHBL2; ANGPT5; Angiopoietin-like 3; ANGPTL3
SWISS: Q9Y5C1
GeneID: 27329
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: ANGPTL3 is a secreted glycoprotein that is structurally related to the angiopoietins. Mature human ANGPTL3 contains an N-terminal coiled coil domain and a C‑terminal fibrinogen-like domain. ANGPTL3 is expressed in the liver from early in development through adulthood. Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism. Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only