Skip to product information
1 of 1

ABclonal

Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein - RP02179

Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein - RP02179

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02179-10, RP02179-20, RP02179-50, RP02179-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Pro166-Ser406) of human ANGPTL4 (Accession #Q9BY76) fused with a 6xHis tag at the N-terminus.

Alternate Names: ANGPTL4, ARP4, FIAF, HARP, HFARP, NL2, PGAR, TGQTL, UNQ171, pp1158

SWISS: Q9BY76

GeneID: 51129

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Angiopoietin-related protein 4 ( ANGPTL4 ) is a secreted protein and contains 1 fibrinogen C-terminal domain. The protein may act as a regulator of angiogenesis and modulate tumorigenesis. It inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. ANGPTL4 may exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity (By similarity). In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details