Recombinant Human Annexin A5/ANXA5 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01180-10, RP01180-20, RP01180-50, RP01180-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Annexin A5/ANXA5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp320) of human Annexin A5/Annexin V/ANXA5 (Accession #NP_001145.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ANX5, ENX2, HEL-S-7, PP4, RPRGL3, ANXA5, ENX2, HEL-S-7, PP4, RPRGL3
SWISS: P08758
GeneID: 308
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human Annexin A5 at 10 μg/mL (100 μL/well) can bind Human GSTO1 with a linear range of 0.15-3.16 μg/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only