Recombinant Human Azurocidin/CAP37/AZU1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00196-10, RP00196-20, RP00196-50, RP00196-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Azurocidin/CAP37/AZU1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Pro250) of human AZU1/Azurocidin 1/CAP37 (Accession #NP_001691.1) fused with a 6×His tag at the C-terminus.
Alternate Names: AZU1, AZAMP, AZU, CAP37, HBP, HUMAZUR, NAZC, hHBP
SWISS: P20160
GeneID: 566
Species: Human
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Azurocidin (AZU1), also known as heparin-binding protein (HBP) or cationic antimicrobial protein 37 (CAP37), is an azurophil granule antibiotic protein, with monocyte chemotactic and antibacterial activity. The Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. Azurocidin is a member of the serine protease family that includes Cathepsin G, neutrophil elastase (NE), and proteinase 3 (PR3). Azurocidin has also been identified as a modulator of endothelial permeability. Neutrophils arriving first at sites of inflammation release Azurocidin, which acts in a paracrine fashion on endothelial cells causing the development of intercellular gaps and allowing leukocyte extravasation. These findings imply that Azurocidin may be a reasonable therapeutic target for a variety of inflammatory disease conditions.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only