Recombinant Human B7-H3/CD276 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01371-10, RP01371-20, RP01371-50, RP01371-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of human B7-H3/CD276 (Accession #NP_079516) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: CD276, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2, CD276 antigen, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2
SWISS: Q5ZPR3-2
GeneID: 80381
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: B7 homolog 3 (B7-H3), a member of the immunoglobulin superfamily, is also known CD276, which contains two Ig-like C2-type (immunoglobulin-like) domains and two Ig-like V-type (immunoglobulin-like) domains.B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is a novel protein structurally related to the B7 family of ligands by the presence of a single set of immunoglobulin-V-like and immunoglobulin-C-like (VC) domains. Previous studies have correlated its overexpression with poor prognosis and decreased tumor-infiltrating lymphocytes in various carcinomas including uterine endometrioid carcinomas, and mounting evidence supports an immuno-inhibitory role in ovarian cancer prognosis. Recently, B7-H3 expression has been reported in several human cancers indicating an additional function of B7-H3 as a regulator of antitumor immunity.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD276 at 2μg/mL (100 μL/well) can bind CD276 Rabbit pAb with a linear range of 0.1-152 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only