ABclonal
Recombinant Human B7-H4/VTCN1 Protein - RP00218
Recombinant Human B7-H4/VTCN1 Protein - RP00218
Couldn't load pickup availability
Recombinant Human B7-H4/VTCN1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00218-10, RP00218-20, RP00218-50, RP00218-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human B7-H4/VTCN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Ala258) of human B7-H4/B7S1/B7x (Accession #NP_078902.2) fused with a 6×His tag at the C-terminus.
Alternate Names: VTCN1, B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1
SWISS: Q7Z7D3
GeneID: 79679
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: B7 homolog 4 (B7-H4, VTCN1) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses.B7-H4 is expressed on the surface of activated lymphocytes, macrophages, monocytes, dendritic cells, epithelial cells, and bone marrow-derived mesenchymal stem cells. Its binding to activated T cells dampens T cell responses and induces cell cycle arrest in the T cell.The B7-H4 protein is also found in ovarian cancer , breast cancer, renal cell carcinoma, and rheumatoid arthritis patients.Research studies indicate that B7-H4 protein is present on the surface of ovarian tumor cells, and that targeted inhibition of B7-H4 using recombinant antibodies restores T cell activation pathways. These studies suggest some potential therapeutic value in blocking B7-H4 function and restoring T cell function in cancer patients.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse B7-H4/VTCN1/VISTA (Catalog: RP00218) at 1 μg/mL (100 μL/well) can bind B7-H4/VTCN1 Rabbit pAb with a linear range of 0.2-22 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
