Recombinant Human B7-H6/NCR3LG1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01356-10, RP01356-20, RP01356-50, RP01356-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human B7-H6/NCR3LG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp25-Ser262) of human B7-H6/NCR3LG1 (Accession #NP_001189368.1) fused with a 6×His tag at the C-terminus.
Alternate Names: B7-H6, NCR3LG1, B7 Homolog 6, NCR3LG1
SWISS: Q68D85
GeneID: 374383
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Natural cytotoxicity triggering receptor 3 ligand 1(B7-H6) is a glycosylated member of the B7 family of immune costimulatory proteins. Mature human B7-H6 consists of a 238 amino acid (aa) extracellular domain (ECD) that contains one Ig-like V domain and one Ig-like C1 domain, a 21 aa transmembrane segment, and a 171 aa cytoplasmic domain that contains one ITIM, one SH2, and one SH3 motif. Both of the Ig-like domains carry N-linked glycosylation. The Ig-like V domain mediates 1:1 stoichiometric binding of B7-H6 to NKp30 expressed on NK cells. It does not show binding to NKp44, NKp46, or NKG2D. Ligation of NKp30 by B7-H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of hematopoietic, carcinoma, and melanoma tumor cells, which is consistent with the detection of NKp30 binding sites on many tumors.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human NCR3LG1 (Catalog: RP01356) at 2 μg/mL (100 μL/well) can bind Mouse NCR3 (Catalog: RP00179) with a linear range of 0.03-46 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only