WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Basigin/EMMPRIN/CD147 Protein - RP00104

Recombinant Human Basigin/EMMPRIN/CD147 Protein - RP00104

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Basigin/EMMPRIN/CD147 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00104-20, RP00104-50, RP00104-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Basigin/EMMPRIN/CD147 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr25-His205) of human CD147/EMMPRIN/Basigin (Accession #NP_001719.2) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: 5F7, CD147, EMMPRIN, OK, TCSF, BSG, 5F7, basigin, CD147, EMMPRIN, OK, TCSF, basigin

SWISS: P35613

GeneID: 682

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human CD147 at 1μg/mL (100 μL/well) can bind CD147 Mouse mAb with a linear range of 0.12-3.05 ng/ml.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only