ABclonal
Recombinant Human Basigin/EMMPRIN/CD147 Protein - RP00104
Recombinant Human Basigin/EMMPRIN/CD147 Protein - RP00104
Couldn't load pickup availability
Recombinant Human Basigin/EMMPRIN/CD147 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00104-20, RP00104-50, RP00104-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Basigin/EMMPRIN/CD147 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr25-His205) of human CD147/EMMPRIN/Basigin (Accession #NP_001719.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: 5F7, CD147, EMMPRIN, OK, TCSF, BSG, 5F7, basigin, CD147, EMMPRIN, OK, TCSF, basigin
SWISS: P35613
GeneID: 682
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human CD147 at 1μg/mL (100 μL/well) can bind CD147 Mouse mAb with a linear range of 0.12-3.05 ng/ml.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
