Recombinant Human Bcl-2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00062-10, RP00062-20, RP00062-50, RP00062-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Bcl-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2) fused with no tags.
Alternate Names: BCL2, Bcl-2, PPP1R50, apoptosis regulator Bcl-2, Bcl-2, PPP1R50
SWISS: P10415
GeneID: 596
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human BCL-XL Protein at 2 μg/mL (100 μL/well) can bind BCL2 (Catalog: RP00062) with a linear range of1.95-126.76ng/mL.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM HEPES,50mM KCl,pH 7.5.Contact us for customized product form or formulation.
Antigen Sequence: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only