Recombinant Human Beta-nerve growth factor/NGFB Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01792-10, RP01792-20, RP01792-50, RP01792-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Beta-nerve growth factor/NGFB Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Ala241) of human NGF (Accession #NP_002497.2) fused with and a 6×His tag at the C-terminus.
Alternate Names: NGFB; HSAN5; Beta-NGF
SWISS: P01138
GeneID: 4803
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: NGF is a well-characterized neurotropic protein that plays a critical role in the development of sympathetic and some sensory neurons in the peripheral nervous system. In addition, NGF can also act in the central nervous system as a trophic factor for basal forebrain cholinergic neurons. NGF has also been shown to have biological effects on non-neuronal tissues. NGF is mitogenic for a factor?dependent human erythroleukemic cell line, TF-1. NGF has been found to increase the number of mast cells in neonatal rats and to induce histamine release from peritoneal mast cells. NGF will enhance histamine release and strongly modulate the formation of lipid mediators by basophils in response to various stimuli. NGF will also induce the growth and differentiation of human B lymphocytes as well as suppress apoptosis of murine peritoneal neutrophils. These results, taken together, suggest that NGF is a pleiotropic cytokine which, in addition to its neurotropic activities, may have an important role in the regulation of the immune system.
Bio-Activity: Recombinant Human NGF stimulates cell proliferation of the TF‑1 human erythroleukemic cells. The ED50 for this effect is 2.2-8.6 ng/mL, corresponding to a specific activity of 1.16×10^5 -4.55×10^5 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only