WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Beta-nerve growth factor/NGFB Protein - RP01792

Recombinant Human Beta-nerve growth factor/NGFB Protein - RP01792

Regular price
$140.00
Regular price
Sale price
$140.00
Unit price
per 
Availability
Sold out

Recombinant Human Beta-nerve growth factor/NGFB Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01792-10, RP01792-20, RP01792-50, RP01792-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Beta-nerve growth factor/NGFB Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Ala241) of human NGF (Accession #NP_002497.2) fused with and a 6×His tag at the C-terminus.

Alternate Names: NGFB; HSAN5; Beta-NGF

SWISS: P01138

GeneID: 4803

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: NGF is a well-characterized neurotropic protein that plays a critical role in the development of sympathetic and some sensory neurons in the peripheral nervous system. In addition, NGF can also act in the central nervous system as a trophic factor for basal forebrain cholinergic neurons. NGF has also been shown to have biological effects on non-neuronal tissues. NGF is mitogenic for a factor?dependent human erythroleukemic cell line, TF-1. NGF has been found to increase the number of mast cells in neonatal rats and to induce histamine release from peritoneal mast cells. NGF will enhance histamine release and strongly modulate the formation of lipid mediators by basophils in response to various stimuli. NGF will also induce the growth and differentiation of human B lymphocytes as well as suppress apoptosis of murine peritoneal neutrophils. These results, taken together, suggest that NGF is a pleiotropic cytokine which, in addition to its neurotropic activities, may have an important role in the regulation of the immune system.

Bio-Activity: Recombinant Human NGF stimulates cell proliferation of the TF‑1 human erythroleukemic cells. The ED50 for this effect is 2.2-8.6 ng/mL, corresponding to a specific activity of 1.16×10^5 -4.55×10^5 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only